Invitrogen™ Human PLXNA4 (aa 892-974) Control Fragment Recombinant Protein

Product Code. 30211351

Brand: Invitrogen™ RP92840

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83113 (PA5-83113. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PLXNA4 is a protein coding gene. Coreceptor for SEMA3A. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance in the developing nervous system. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm.

Specifications

• Accession Number: Q9HCM2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 91584
• Name: Human PLXNA4 (aa 892-974) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9330117B14; FAYV2820; Kiaa1550; mKIAA1550; OTTHUMP00000207245; PLEXA4; plexin A4; plexin A4, A; plexin-A4; Plxa4; Plxna4; Plxna4a; PLXNA4B; PRO34003; UNQ2820/PRO34003
• Common Name: PLXNA4
• Gene Symbol: Plxna4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SHVKVAGVECSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLKPSRGPMSGGTQVTI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining