missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PLSCR3 (aa 189-255) Control Fragment Recombinant Protein

Product Code. 30197943
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30197943 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30197943 Supplier Invitrogen™ Supplier No. RP103921

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-65512 (PA5-65512, PA5-64376 (PA5-64376. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. Seems to play a role in apoptosis, through translocation of cardiolipin from the inner to the outer mitochondrial membrane which promotes BID recruitment and enhances tBid-induced mitochondrial damages. [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NRY6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57048
Name Human PLSCR3 (aa 189-255) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2210403O21Rik; 2610037N06Rik; Ca 2+ dependent phospholipid scramblase 3; ca(2+)-dependent phospholipid scramblase 3; ESTM3; LOW QUALITY PROTEIN: phospholipid scramblase 3; LOW QUALITY PROTEIN: phospholipid scramblase 3; phospholipid scramblase 3; phospholipid scramblase 3; PL scramblase 3; Pls3; Plscr3; Unknown (protein for MGC:138060); X83310
Common Name PLSCR3
Gene Symbol Plscr3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.