Invitrogen™ Human PLOD3 (aa 459-511) Control Fragment Recombinant Protein

Product Code. 30198512

Brand: Invitrogen™ RP110212

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Forms hydroxylysine residues in -Xaa-Lys-Gly- sequences in collagens. These hydroxylysines serve as sites of attachment for carbohydrate units and are essential for the stability of the intermolecular collagen cross-links.

Specifications

• Accession Number: O60568
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8985
• Name: Human PLOD3 (aa 459-511) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI414586; bone protein I (BP-I); Galactosylhydroxylysine-glucosyltransferase; LH3; lysine hydroxylase 3; lysyl hydroxlase 3; lysyl hydroxylase 2; lysyl hydroxylase 3; Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3; Plod3; Procollagen galactosyltransferase; Procollagen glucosyltransferase; Procollagen glycosyltransferase; procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3; procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
• Common Name: PLOD3
• Gene Symbol: PLOD3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PYISQAYVIRGDTLRMELPQRDVFSGSDTDPDMAFCKSFRDKGIFLHLSNQHE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining