Invitrogen™ Human PLLP (aa 1-35) Control Fragment Recombinant Protein

Product Code. 30180533

Brand: Invitrogen™ RP98551

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plasmolipin is an 18 kDa membrane-bound proteolipid that belongs to the tetraspan (4TM) family, a rapidly growing group of myelin-associated proteins. Many of these proteins could be linked to human hereditary demyelinating neuropathies. Studies indicate that plasmolipin is a component of the cytoskeletal structure and has been localized to the apical surface of tubular epithelial cells. It has been shown that, upon addition to lipid bilayers, plasmolipin induces formation of ion channels that are both voltage-dependent and potassium-specific. Plasmolipin was originally isolated from kidney tissue. Subsequently, it has been shown to be widely expressed, not only being present in kidney, but also in the nervous system, thymus, testis, lung, and thyroid gland.

Specifications

• Accession Number: Q9Y342
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51090
• Name: Human PLLP (aa 1-35) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610010I06Rik; AV001002; Plapi; Plasma membrane proteolipid; plasma membrane proteolipid (plasmolipin); plasmolipin; PLLP; PMLP; Tm4sf11; transmembrane 4 superfamily member 11; transmembrane 4 superfamily member 11 (plasmolipin)
• Common Name: PLLP
• Gene Symbol: PLLP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining