Invitrogen™ Human PLK5 (aa 2-67) Control Fragment Recombinant Protein

Product Code. 30197054

Brand: Invitrogen™ RP97250

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57120 (PA5-57120. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Inactive serine/threonine-protein kinase that plays a role in cell cycle progression and neuronal differentiation. [UniProt]

Specifications

• Accession Number: Q496M5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 126520
• Name: Human PLK5 (aa 2-67) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6330514A18Rik; FG060302; Inactive serine/threonine-protein kinase PLK5; PLK5; PLK-5; PLK5P; polo like kinase 5; polo-like kinase 5; polo-like kinase 5 pseudogene; polo-like kinase 5, pseudogene; serine/threonine-protein kinase PLK5; SgK384ps
• Common Name: PLK5
• Gene Symbol: Plk5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YTVLTGTPPFMASPLSEMYQNIREGHYPEPAHLSANARRLIVHLLAPNPAERPSLDHLLQDDFFTQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining