Invitrogen™ Human PLEKHO2 (aa 264-348) Control Fragment Recombinant Protein

Code produit. 30180733

Marque: Invitrogen™ RP98130

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59046 (PA5-59046. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Pleckstrin homology domain-containing proteins family O member 2 (PLEKHO2)'s function remains largely unknown. Genetic polymorphisms of PLEKHO2 contribute to diabetic retinopathy (DR) development. Functional prediction analysis strengthened the likelihood of participation of PLEKHO2 in the development of DR (Eric C. Han et al., 2012).

Spécification

• Accession Number: Q8TD55
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80301
• Name: Human PLEKHO2 (aa 264-348) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI840980; PH domain-containing family O member 2; PH domain-containing family Q member 1; PH domain-containing protein; PH domain-containing protein homolog; pleckstrin homology domain containing O2; pleckstrin homology domain containing, family O member 2; pleckstrin homology domain containing, family Q member 1; pleckstrin homology domain-containing family O member 2; Pleckstrin homology domain-containing family Q member 1; PLEKHO2; Plekhq1; PP1628; pp9099
• Common Name: PLEKHO2
• Gene Symbol: PLEKHO2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SVLPDKLKVSWENPSPQEAPAAESAEPSQAPCSETSEAAPREGGKPPTPPPKILSEKLKASMGEMQASGPPAPGTVQVSVNGMDD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining