Invitrogen™ Human PLEKHH2 (aa 304-373) Control Fragment Recombinant Protein

Product Code. 30194887

Brand: Invitrogen™ RP108108

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67446 (PA5-67446. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PLEKHH2 contains 1 FERM domain, 1 MyTH4 domain and 2 PH domains. It is a Single-pass membrane protein. The exact function of PLEKHH2 remains unknown.

Specifications

• Accession Number: Q8IVE3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 130271
• Name: Human PLEKHH2 (aa 304-373) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI256725; E030001K05; KIAA2028; mKIAA2028; pleckstrin homology domain containing, family H (with MyTH4 domain) member 2; pleckstrin homology domain-containing family H member 2; pleckstrin homology, MyTH4 and FERM domain containing H2; PLEKHH1L; PLEKHH2; RGD1304935; si:ch73-105b23.3
• Common Name: PLEKHH2
• Gene Symbol: PLEKHH2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: STLSSHTSEEGVQCSRMGSEMYLTASDDSSSIFEEETFGIKRPEHKKLYSWQQEAQWKALNSPLGKGNSE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining