Invitrogen™ Human PLEKHG1 (aa 1158-1252) Control Fragment Recombinant Protein

Product Code. 30204887

Brand: Invitrogen™ RP94726

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55582 (PA5-55582. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PLEKHG1 gene ontology annotations related to this gene include regulation of Rho protein signal transduction.

Specifications

• Accession Number: Q9ULL1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57480
• Name: Human PLEKHG1 (aa 1158-1252) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ARHGEF41; KIAA1209; pleckstrin homology and RhoGEF domain containing G1; pleckstrin homology domain containing, family G (with RhoGef domain) member 1; pleckstrin homology domain-containing family G member 1; PLEKHG1
• Common Name: PLEKHG1
• Gene Symbol: PLEKHG1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CQDHLYNSLGRKGISAKSQPYHRSQSSSSVLINKSMDSINYPSDVGKQQLLSLHRSSRCESHQDLLPDIADSHQQGTEKLSDLTLQDSQKVVVVN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining