Invitrogen™ Human PLEKHB2 (aa 144-205) Control Fragment Recombinant Protein

Product Code. 30196096

Brand: Invitrogen™ RP108645

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84970 (PA5-84970. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PLEKHB2 gene ontology annotations related to this gene include regulation of cell differentiation.

Specifications

• Accession Number: Q96CS7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55041
• Name: Human PLEKHB2 (aa 144-205) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310009M15Rik; AU018239; evectin 2; evectin-2; Evt2; evt-2; PH domain-containing family B member 2; Phdc; pleckstrin homology domain containing B2; pleckstrin homology domain containing, family B (evectins) member 2; pleckstrin homology domain containing, family B member 2; pleckstrin homology domain-containing family B member 2; pleckstrin homology domain-containing family B member 2-like; PLEKHB2; si:dkey-121a11.4; similar to pleckstrin homology domain containing, family B (evectins) member 2; zgc:55604
• Common Name: PLEKHB2
• Gene Symbol: PLEKHB2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining