Invitrogen™ Human PLEKHA6 (aa 753-822) Control Fragment Recombinant Protein

Product Code. 30197390

Brand: Invitrogen™ RP108779

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PLEKHA6 (Pleckstrin Homology Domain Containing A6) is a Protein Coding gene. Among its related pathways arePI MetabolismandGlycerophospholipid biosynthesis.

Specifications

• Accession Number: Q9Y2H5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22874
• Name: Human PLEKHA6 (aa 753-822) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9530028L01Rik; AU042621; KIAA0969; LOW QUALITY PROTEIN: pleckstrin homology domain-containing family A member 6; PEPP3; PEPP-3; PH domain-containing family A member 6; phosphoinositol 3-phosphate-binding protein 3; phosphoinositol 3-phosphate-binding protein-3; pleckstrin homology domain containing A6; pleckstrin homology domain containing, family A member 6; pleckstrin homology domain-containing family A member 6; pleckstrin homology domain-containing family A member 6; LOW QUALITY PROTEIN: pleckstrin homology domain-containing family A member 6; Plekha6; RGD1564395
• Common Name: PLEKHA6
• Gene Symbol: PLEKHA6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TRQEVEAEKQAALNKVGVVPPRTKSPTDDEVTPSAVVRRNASGLTNGLSSQERPKSAVFPGEGKVKMSVE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining