Invitrogen™ Human PLBD2 (aa 448-565) Control Fragment Recombinant Protein

Product Code. 30197425

Brand: Invitrogen™ RP90359

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53557 (PA5-53557. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PLBD2 (Phospholipase B Domain Containing 2) is a Protein Coding gene. Diseases associated with PLBD2 include Gallbladder Papillomatosis and Gm1-Gangliosidosis, Type Iii. Gene Ontology (GO) annotations related to this gene include hydrolase activity. An important paralog of this gene is PLBD1.

Specifications

• Accession Number: Q8NHP8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 196463
• Name: Human PLBD2 (aa 448-565) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300012G16Rik; 66.3 kDa protein; 76 kDa protein; AU019810; LAMA-like protein 2; Lamina ancestor homolog 2; mannose-6-phosphate protein associated protein p76; mannose-6-phosphate protein p76; p76; phospholipase B domain containing 2; phospholipase B domain-containing protein 2; phospholipase B-like 2 32 kDa form; phospholipase B-like 2 45 kDa form; PLB homolog 2; Plbd2; Putative phospholipase B-like 2; Putative phospholipase B-like 2 15 kDa form; Putative phospholipase B-like 2 28 kDa form; Putative phospholipase B-like 2 32 kDa form; Putative phospholipase B-like 2 40 kDa form; Putative phospholipase B-like 2 45 kDa form; RDCR-0918-3; RDCR-0918-3 protein
• Common Name: PLBD2
• Gene Symbol: PLBD2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLSLCKACNPQPNGENAISARSDLNPANGSYPFQALRQRSHGGIDVKVTSMSLARILSLLAASGPTWDQVPPFQWSTS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining