Invitrogen™ Human PLAGL1 (aa 209-294) Control Fragment Recombinant Protein

Product Code. 30205604

Brand: Invitrogen™ RP105023

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65970 (PA5-65970. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a C2H2 zinc finger protein with transactivation and DNA-binding activities. It has been shown to have anti-proliferative properties, and thus thought to function as a tumor suppressor. In addition, overexpression of this gene during fetal development is believed to underlie the rare disorder, transient neonatal diabetes mellitus (TNDM). This gene is imprinted, with preferential expression of the paternal allele in many tissues, however, biallelic expression has been noted in peripheral blood leucocytes. A recent study reports that tissue-specific imprinting results from variable utilization of monoallelic and biallelic promoters. Many transcript variants differing in the 5' UTR and encoding two different isoforms, have been found for this gene.

Specifications

• Accession Number: Q9UM63
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5325
• Name: Human PLAGL1 (aa 209-294) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Lost on transformation 1; LOT1; LOT-1; PLAG1 like zinc finger 1; PLAGL1; PLAG-like 1; pleiomorphic adenoma gene-like 1; Pleiomorphic adenoma-like protein 1; Tumor suppressor ZAC; ZAC; Zac1; zinc finger protein PLAGL1; zinc finger protein regulator of apoptosis and cell cycle arrest; zinc finger protein Zac 1
• Common Name: PLAGL1
• Gene Symbol: Plagl1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QELMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining