Invitrogen™ Human PLA2R1 (aa 395-530) Control Fragment Recombinant Protein

Product Code. 30195301

Brand: Invitrogen™ RP90366

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52966 (PA5-52966. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Receptor for secretory phospholipase A2 (sPLA2). Acts as a receptor for phosholipase sPLA2-IB/PLA2G1B but not sPLA2-IIA/PLA2G2A. Also able to bind to snake PA2-like toxins. Although its precise function remains unclear, binding of sPLA2 to its receptor participates in both positive and negative regulation of sPLA2 functions as well as clearance of sPLA2. Binding of sPLA2-IB/PLA2G1B induces various effects depending on the cell type, such as activation of the mitogen-activated protein kinase (MAPK) cascade to induce cell proliferation, the production of lipid mediators, selective release of arachidonic acid in bone marrow-derived mast cells. In neutrophils, binding of sPLA2-IB/PLA2G1B can activate p38 MAPK to stimulate elastase release and cell adhesion.

Specifikationer

• Accession Number: Q13018
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22925
• Name: Human PLA2R1 (aa 395-530) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 180 kDa secretory phospholipase A2 receptor; CLEC13C; C-type lectin domain family 13 member C; mannose receptor, C type 2; Mrc2; M-type receptor; phospholipase A2 receptor 1; phospholipase A2 receptor 1, 180 kD; phospholipase A2 receptor 1, 180 kDa; phospholipase A2, group IB, pancreas, receptor; Pla2g1br; PLA2G1R; PLA2-I receptor; PLA2IR; Pla2r; Pla2-r; PLA2R1; Secretory phospholipase A2 receptor; Soluble PLA2-R; Soluble secretory phospholipase A2 receptor
• Common Name: PLA2R1
• Gene Symbol: Pla2r1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining