Invitrogen™ Human PLA2G4E (aa 696-786) Control Fragment Recombinant Protein

Product Code. 30180504

Brand: Invitrogen™ RP98179

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59428 (PA5-59428. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the cytosolic phospholipase A2 group IV family. Members of this family are involved in regulation of membrane tubule-mediated transport. The enzyme encoded by this member of the family plays a role in trafficking through the clathrin-independent endocytic pathway. The enzyme regulates the recycling process via formation of tubules that transport internalized clathrin-independent cargo proteins back to the cell surface.

Specifications

• Accession Number: Q3MJ16
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 123745
• Name: Human PLA2G4E (aa 696-786) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310026J01Rik; C230096D22; cPLA2-epsilon; cytosolic phospholipase A2 epsilon; EC 3.1.1.4; Phospholipase A2 group IVE; phospholipase A2, group 4 E; phospholipase A2, group IVE; Pla2epsilon; Pla2g4e; RGD1310595
• Common Name: PLA2G4E
• Gene Symbol: Pla2g4e
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LCLLDTAFFVNSSYPPLLRPERKADLIIHLNYCAGSQTKPLKQTCEYCTVQNIPFPKYELPDENENLKECYLMENPQEPDAPIVTFFPLIN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining