Invitrogen™ Human PLA2G4D (aa 188-265) Control Fragment Recombinant Protein

Artikelnummer. 30212185

missing translation for 'mfr': Invitrogen™ RP109863

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145068 (PA5-145068. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The phospholipase A2 enzyme family, including PLA2G4D, catalyze the hydrolysis of glycerophospholipids at the sn-2 position and then liberate free fatty acids and lysophospholipids.[supplied by OMIM, Jun 2009].

Spezifikation

• Accession Number: Q86XP0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 283748
• Name: Human PLA2G4D (aa 188-265) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610311B01Rik; cPLA2delta; cPLA2-delta; cytosolic phospholipase A2 delta; phospholipase A2 delta, cytosolic; phospholipase A2 group IVD; phospholipase A2, group IVD; phospholipase A2, group IVD (cytosolic); Pla2delta; PLA2G4D
• Common Name: PLA2G4D
• Gene Symbol: PLA2G4D
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VLKGSYEDTQTSFLGTASAFRFHYMAALETELSGRLRSSRSNGWNGDNSAGYLTVPLRPLTIGKEVTMDVPAPNAPGV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining