Invitrogen™ Human PLA1A (aa 391-455) Control Fragment Recombinant Protein

Product Code. 30205099

Brand: Invitrogen™ RP106963

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66277 (PA5-66277. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PLA1A is a phospholipase that hydrolyzes fatty acids at the sn-1 position of phosphatidylserine and 1-acyl-2-lysophosphatidylserine. This secreted protein hydrolyzes phosphatidylserine (PS) in liposomes and can also hydrolyze PS in apoptotic cells and activate platelets where the resulting 2-acyl-lysophosphatidylserine acts as a lipid mediator for mast cells, T cells, and neural cells, suggesting that a major function of PLA1A may be the production of lysophospholipid mediators. PLA1A is upregulated in rat peripheral blood cells bearing long-term surviving cardiac allograft. PLA1A is also expressed in human THP-1-derived macrophages and this expression is upregulated in cells treated with lipopolysaccharide, a TLR4 ligand. This upregulation is inhibited with corticosteroids, which are often used at high dosages to suppress chronic allograft rejection.

Specifications

• Accession Number: Q53H76
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51365
• Name: Human PLA1A (aa 391-455) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA986889; NMD; Phosphatidylserine-specific phospholipase A1; phosphatidylserine-specific phospholipase A1alpha; phospholipase A1 member A; PLA1A; PSPLA1; PS-PLA1
• Common Name: PLA1A
• Gene Symbol: PLA1A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QCQINQVKFKFQSSNRVWKKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCDLKIAC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining