missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PLA1 (aa 4-117) Control Fragment Recombinant Protein

Product Code. 30212972
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212972

Brand: Invitrogen™ RP102297

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82686 (PA5-82686. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the POU domain family of transcription factors. POU domain transcription factors bind to a specific octamer DNA motif and regulate cell type-specific differentiation pathways. The encoded protein is primarily expressed in the epidermis, and plays a critical role in keratinocyte proliferation and differentiation. The encoded protein is also a candidate tumor suppressor protein, and aberrant promoter methylation of this gene may play a role in cervical cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011].
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UKI9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 25833
Name Human PLA1 (aa 4-117) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 11-Oct; Epoc-1; FLJ40063; LOC553427 protein; MGC126698; Oct11; oct-11; Oct-11 A; octamer-binding protein 11; Octamer-binding transcription factor 11; OTF11; OTF-11; PLA1; PLA-1; POU class 2 homeobox 3; POU domain transcription factor OCT11a; POU domain, class 2, transcription factor 3; POU transcription factor; POU2F3; Rov 1 pou-homeodomain protein; Skin; Skin-1 A; Skn-1 A; Skn-li; Transcription factor PLA-1; transcription factor Skn-1; zgc:136377; zgc:158534
Common Name PLA1
Gene Symbol POU2F3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.