Invitrogen™ Human PKNOX2 (aa 352-409) Control Fragment Recombinant Protein

Product Code. 30195803

Brand: Invitrogen™ RP106627

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65946 (PA5-65946. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PREP-2 (Pbx-regulating protein-2), also known as PBX/knotted 1 homeobox 2 or PKNOX2, is a widely expressed protein belonging to the TALE (three amino acid loop extension)/MEIS family. PREP-2 is a DNA-binding protein that forms stable complexes with Pbx proteins. It is highly homologous to the related protein PREP-1, but displays a more restricted tissue distribution and a higher DNA-dissociation rate. Like PREP-1, PREP-2 forms a heterodimer with Pbx 1. The PREP-2-Pbx 1 dimer is relocated to the nucleus where it associates with HoxB1 to form a ternary complex. In contrast with PREP-1, which acts to increase transcriptional activation in this ternary complex, PREP-2 leads to a slight decrease in transcriptional activity of the ternary complex. Multiple isoforms exist for PREP-2, localizing to the nucleus or cytoplasm. Cytoplasmic isoforms are believed to colocalize with F-actin, G-actin and tubulin/microtubules.

Specifications

• Accession Number: Q96KN3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 63876
• Name: Human PKNOX2 (aa 352-409) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: D230005H23Rik; homeobox protein Meis2-like; homeobox protein PKNO x 2; Homeobox protein PREP-2; homeodomain containing transcription factor PREP2; Pbx/knotted 1 homeobox 2; PBX/knotted homeobox 2; Pkno x 2; PREP2
• Common Name: PKNOX2
• Gene Symbol: PKNOX2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DASNPDPAPKAKKIKSQHRPTQRFWPNSIAAGVLQQQGGAPGTNPDGSINLDNLQSLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining