missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30182763

Invitrogen™ Human PKD2L2 (aa 138-226) Control Fragment Recombinant Protein

Produktkod. 30182763
Klicka för att se tillgängliga alternativ
Quantity:
100 μL
Förpackningsstorlek:
100µL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30182763

Brand: Invitrogen™ RP98338

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60446 (PA5-60446. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRUSTED_SUSTAINABILITY

Specifikationer

Accession Number Q9NZM6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27039
Name Human PKD2L2 (aa 138-226) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias PK2L2; PKD2L2; polycystic kidney disease 2-like 2; polycystic kidney disease 2-like 2 protein; Polycystin - L2; polycystin 2 like 2, transient receptor potential cation channel; polycystin-2L2; Polycystin-L2; transient receptor potential cation channel subfamily P member 5; TRPP5
Common Name PKD2L2
Gene Symbol PKD2L2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYSTSNTNSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.