Invitrogen™ Human PKD2 (aa 786-927) Control Fragment Recombinant Protein

Product Code. 30195585

Brand: Invitrogen™ RP91419

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110806 (PA5-110806. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. The encoded protein may function in renal tubular development, morphology, and function, and may modulate intracellular calcium homoeostasis and other signal transduction pathways. This protein interacts with polycystin 1 to produce cation-permeable currents. Mutations in this gene have been associated with autosomal dominant polycystic kidney disease.

Specifications

• Accession Number: Q13563
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5311
• Name: Human PKD2 (aa 786-927) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A MGC138466; APKD2; Autosomal dominant polycystic kidney disease type II protein; C030034P18Rik; MGC138468; PC2; Pc-2; PKD2; PKD4; polycystic kidney disease 2; polycystic kidney disease 2 (autosomal dominant); polycystic kidney disease 2 homolog; Polycystic kidney disease 2 protein; Polycystic kidney disease 2 protein homolog; polycystin 2; polycystin 2, transient receptor potential cation channel; polycystin-2; Polycystwin; R48321; RGD1559992; transient receptor potential cation channel subfamily P member 2; transient receptor potential cation channel, subfamily P, member 2; TRPP1; TRPP2
• Common Name: PKD2
• Gene Symbol: PKD2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: REDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining