Invitrogen™ Human PKC zeta (aa 138-277) Control Fragment Recombinant Protein

Product Code. 30196220

Brand: Invitrogen™ RP88837

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The PKC family of serine/threonine kinases, including PRKCZ (PKC zeta), is activated intracellularly by signal transduction pathways. In humans, at least 12 different PKC polypeptides have been identified. These isoforms differ in primary structure, tissue distribution, subcellular localization, mode of action in vitro, response to extracellular signals, and substrate specificity. PKC alpha, beta I, beta II and gamma form the conventional family; their activities are Ca2+- and phospholipid-dependent. PKC zeta plays a key regulatory role in a variety of cellular functions including cell growth and differentiation, gene expression, hormone secretion and membrane function.

Specifications

• Accession Number: Q05513
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5590
• Name: Human PKC zeta (aa 138-277) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 14 - 3 - 3 - zeta isoform; 14-3-3-zetaisoform; AI098070; aPKCzeta; atypical protein kinase C; C80388; kinase nPKC-zeta; KPCZ; nPKC-zeta; nPKC-zeta PRKCZ; PKC2; Pkcz; PKC-ZETA; Prkcz; protein kinase C zeta; protein kinase C zeta subspecies; protein kinase C zeta type; protein kinase C, zeta; r14-3-3; R74924; zetaPKC
• Common Name: PKC zeta
• Gene Symbol: PRKCZ
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining