Invitrogen™ Human PKA beta (aa 1-93) Control Fragment Recombinant Protein

Product Code. 30205088

Brand: Invitrogen™ RP102341

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83105 (PA5-83105. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The catalytic subunit C-beta of PKA (PRKACB) is a member of the Ser/Thr protein kinase family (the PKA catalytic subunit consist of three gene products: C-alpha, C-beta, and C-gamma) and has been assigned to human chromosome region 1p36.1. PRKACB is derived from a gene distinct from C-alpha and shows tissue-specific expression. At the amino acid level C-alpha and C-beta showed 93% homology. The inactive holoenzyme of AMPK is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits of AMPK have been identified in humans.

Specifications

• Accession Number: P22694
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5567
• Name: Human Pk. beta (aa 1-93) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: cAMP-dependent protein kinase C beta; cAMP-dependent protein kinase catalytic beta subunit isoform 4 ab; cAMP-dependent protein kinase catalytic subunit beta; Pk. C-beta; Pkacb; PRKACB; protein kinase A catalytic subunit beta; protein kinase cAMP-activated catalytic subunit beta; protein kinase, cAMP dependent, catalytic, beta; protein kinase, cAMP-dependent, beta catalytic subunit; protein kinase, cAMP-dependent, catalytic, beta
• Common Name: Pk. beta
• Gene Symbol: PRKACB
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MAAYREPPCNQYTGTTTALQKLEGFASRLFHRHSKGTAHDQKTALENDSLHFSEHTALWDRSMKEFLAKAKEDFLKKWENPTQNNAGLEDFER
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining