missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PITX2 (aa 11-84) Control Fragment Recombinant Protein

Product Code. 30204001
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204001

Brand: Invitrogen™ RP106258

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65596 (PA5-65596. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Pilx2 is a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. This protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. It plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this protein are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q99697
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5308
Name Human PITX2 (aa 11-84) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9430085M16Rik; all1-responsive gene 1; ALL1-responsive protein ARP1; Arp1; Br x 1; BR x 1 homeoprotein; Br x 1 b; Homeobox protein PIT x 2; homeodomain transcription factor 2; IDG2; IGDS; IGDS2; IHG2; IRID2; Munc30; orthodenticle-like homeobox 2; Otl x 2; paired like homeodomain 2; paired like homeodomain transcription factor 2; paired-like homeodomain 1; paired-like homeodomain 2; paired-like homeodomain transcription factor 1; paired-like homeodomain transcription factor 2; paired-like homeodomain transcription factor 2 c; paired-like homeodomain transcription factor Munc 30; Pituitary homeobox 2; PIT x 1; Pit x 2; Pitx-2; Pit x 2 c; Pt x 2; Rgs; Rieg; RIEG bicoid-related homeobox transcription factor; rieg bicoid-related homeobox transcription factor 1; RIEG1; rPt x 2; RS; S a 1 glycoprotein; S a1glycoprotein; S alpha 1 glycoprotein; S a 1 glycoprotein; S a1glycoprotein; Solurshin
Common Name PITX2
Gene Symbol PITX2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.