missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211789

Invitrogen™ Human PITPNM1 (aa 589-651) Control Fragment Recombinant Protein

Product Code. 30211789
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211789

Brand: Invitrogen™ RP107193

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66530 (PA5-66530. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulates RHOA activity, and plays a role in cytoskeleton remodeling. Necessary for normal completion of cytokinesis. Plays a role in maintaining normal diacylglycerol levels in the Golgi apparatus. Binds phosphatidyl inositol phosphates (in vitro). May catalyze the transfer of phosphatidylinositol and phosphatidylcholine between membranes. Necessary for maintaining the normal structure of the endoplasmic reticulum and the Golgi apparatus. Required for protein export from the endoplasmic reticulum and the Golgi. Binds calcium ions.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O00562
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9600
Name Human PITPNM1 (aa 589-651) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Dres9; drosophila retinal degeneration B homolog; Drosophila retinal degeneration B homolog 1; FLJ44997; membrane-associated phosphatidylinositol transfer protein 1; Mpt1; Mpt-1; NIR2; Nir-2; phosphatidylinositol membrane-associated; phosphatidylinositol transfer protein membrane associated 1; phosphatidylinositol transfer protein, membrane associated 1; phosphatidylinositol transfer protein, membrane-associated 1; Pitpnm; PITPnm 1; PITPNM1; Pyk2 N-terminal domain-interacting receptor 2; R75447; Rd9; RdgB; RDGB1; RDGBA; RDGBA1; retinal degeneration 9; retinal degeneration B alpha 1
Common Name PITPNM1
Gene Symbol PITPNM1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SRRGSMNNELLSPEFGPVRDPLADGVEGLGRGSPEPSALPPQRIPSDMASPEPEGSQNSLQAA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.