Invitrogen™ Human PIT1 (aa 184-249) Control Fragment Recombinant Protein

Product Code. 30182826

Brand: Invitrogen™ RP98326

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59662 (PA5-59662. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PIT1 is a pituitary-specific transcription factor responsible for pituitary development and hormone expression in mammals and is a member of the POU family of transcription factors that regulate mammalian development. The POU family is so named because the first 3 members identified were PIT1 and OCT1 of mammals, and Unc-86 of C. elegans. PIT1 contains 2 protein domains, termed POU-specific and POU-homeo, which are both necessary for high affinity DNA binding on genes encoding growth hormone and prolactin. PIT1 is also important for regulation of the genes encoding prolactin and thyroid-stimulating hormone beta subunit by thyrotropin-releasing hormone and cyclic AMP.

Specifications

• Accession Number: P28069
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5449
• Name: Human PIT1 (aa 184-249) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CPHD1; dw; dwarf; GHF1; GHF-1; GHF1A; growth hormone factor 1; Hmp1; homeodomain protein for Growth Hormone (GH); PIT1; pit-1; Pit1-rs1; PIT1Z; Pituary specific transcription factor 1 (growth hormone factor 1); pituitary specific transcription factor 1; pituitary specific transcription factor 1, related sequence 1; pituitary-specific positive transcription factor 1; pituitary-specific positive transcription factor 1 variant w; POU class 1 homeobox 1; POU domain, class 1, transcription factor 1; POU domain, class 1, transcription factor 1 (Pit1, growth hormone factor 1); POU1F1; POU1F1a; transcription factor Pit-1
• Common Name: PIT1
• Gene Symbol: POU1F1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining