Invitrogen™ Human PIST (aa 260-359) Control Fragment Recombinant Protein

Product Code. 30207468

Brand: Invitrogen™ RP92548

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PDZ domains contain approximately 90 amino acids and bind the extreme C terminus of proteins in a sequence-specific manner. PIST, a PDZ domain-containing Golgi protein, was discovered in a yeast two-hybrid system as a binding partner to Beclin-1, a Bcl-2-interacting protein homologous to the yeast autophagy gene apg6. Experiments with mutant PIST proteins lacking the PDZ domain showed that PIST interaction with Beclin-1 through its coiled-coil domain can modulate Beclin-1 activity and suggest that PIST interactions with other proteins through its PDZ domain may regulate the activity of PIST and Beclin-1.

Specifications

• Accession Number: Q9HD26
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57120
• Name: Human PIST (aa 260-359) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2210402P09Rik; AI844555; CAL; CFTR-associated ligand; dJ94G16.2; dJ94G16.2 PIST; FIG; Fused in glioblastoma; golgi associated PDZ and coiled-coil motif containing; Golgi associated PDZ and coiled-coil motif containing protein; golgi-associated PDZ and coiled-coil motif containing protein; Golgi-associated PDZ and coiled-coil motif-containing protein; Gopc; GOPC1; PDZ domain-containing protein PIST; PDZ protein interacting specifically with TC10; PDZ/coiled-coil domain binding partner for the rho-family GTPase TC10; PIST
• Common Name: PIST
• Gene Symbol: GOPC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining