Invitrogen™ Human PIM3 (aa 51-95) Control Fragment Recombinant Protein

Product Code. 30198418

Brand: Invitrogen™ RP107650

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67010 (PA5-67010. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PIM3 serine/threonine kinase or PIM-3 oncogene belongs to a family of protooncogenes. PIM3 is expressed in hepatocellular carcinoma development and plays a main role in the proliferation of human hepatoma cell lines. PIM3 also expressed in human pancreatic cancer cells and phosphorylates BAD to block Bad-mediated apoptosis in human pancreatic cancer cell lines. PIM3 is widely expressed, with the exception of no expression observed in colon, thymus, and small intestine.

Specifications

• Accession Number: Q86V86
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 415116
• Name: Human PIM3 (aa 51-95) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BC026639; Kid1; KID-1/kinase induced by depolarization; Pim3; pim-3; pim-3 oncogene; Pim-3 proto-oncogene, serine/threonine kinase; proviral integration site 3; serine/threonine kinase Pim-3; serine/threonine-protein kinase pim-3
• Common Name: PIM3
• Gene Symbol: PIM3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FGTVYAGSRIADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining