Invitrogen™ Human PIK3R6 (aa 636-741) Control Fragment Recombinant Protein

Product Code. 30212878

Brand: Invitrogen™ RP93428

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54689 (PA5-54689. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

p87PIKAP (p87 PI3K adapter protein), also known as PIK3R6 (phosphoinositide-3-kinase, regulatory subunit 6), p84 or HsT41028, is a 754 amino acid cytoplasmic protein that functions as a regulatory subunit of the PI 3-kinase p110 complex. Expressed in heart, dendritic cells, macrophages and neutrophils, p87PIKAP drives PI 3-kinase p110 activation, interacts with PDE3B and is thought to cause the two proteins to form a scaffolding interaction. The gene encoding p87PIKAP maps to human chromosome 17, which comprises over 2.5% of the human genome and encodes over 1, 200 genes. Two key tumor suppressor genes are associated with chromosome 17, namely, p53 and BRCA1. Tumor suppressor p53 is necessary for maintenance of cellular genetic integrity by moderating cell fate through DNA repair versus cell death. Like p53, BRCA1 is directly involved in DNA repair, though specifically it is recognized as a genetic determinant of early onset breast cancer and predisposition to cancers of the ovary, colon, prostate gland and fallopian tubes.

Specifications

• Accession Number: Q5UE93
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 146850
• Name: Human PIK3R6 (aa 636-741) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BB220380; C17orf38; HsT41028; p84; p84 PI3K adapter protein; p84 PIKAP; p87 phosphoinositide 3-kinase gamma (PI3Kg) adapter protein; p87 phosphoinositide 3-kinase gamma adapter; p87 PI3K adapter protein; p87(PIKAP); p87PIKAP; Phosphoinositide 3-kinase gamma adapter protein of 87 kDa; Phosphoinositide 3-kinase regulatory subunit 6; phosphoinositide-3-kinase regulatory subunit 6; phosphoinositide-3-kinase, regulatory subunit 6; PI3Kgamma adapter protein of 87 kDa; PIK3R6; RGD1560850
• Common Name: PIK3R6
• Gene Symbol: PIK3R6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PAAPVTDHTCLNVNVTEVVKSSNLAGKSFSTVTNTFRTNNIQIQSRDQRLLTLSLDKDDQRTFRDVVRFEVAPCPEPCSGAQKSKAPWLNLHGQQEVEAIKAKPKP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining