Invitrogen™ Human PIK3CG (aa 455-535) Control Fragment Recombinant Protein

Product Code. 30212470

Brand: Invitrogen™ RP107726

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111655 (PA5-111655. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PIK3CG (p110 gamma) is the sole class IB phosphatidylinositol 3-kinase family member, which along with the class IA family members, generates the important second messenger PIP2. However, unlike the class IA enzymes which signal downstream of receptor tyrosine kinases, PIK3CG primarily signals downstream of GPCRs. The gene product is an enzyme that phosphorylates phosphoinositides on the 3-hydroxyl group of the inositol ring. It is an important modulator of extracellular signals, including those elicited by E-cadherin-mediated cell-cell adhesion, which plays an important role in maintenance of the structural and functional integrity of epithelia. In addition to its role in promoting assembly of adherens junctions, the protein is thought to play a pivotal role in the regulation of cytotoxicity in NK cells. The gene is located in a commonly deleted segment of chromosome 7 previously identified in myeloid leukemias.

Specifications

• Accession Number: P48736
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5294
• Name: Human PIK3CG (aa 455-535) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1-phosphatidylinositol 3-kinase; 5830428L06Rik; EGK_14026; p110gamma; p110-gamma; p120-PI3K; phosphatidylinositol 3 kinase gamma, p110 gamma; phosphatidylinositol 3-kinase catalytic 110-kD gamma; phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma; Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform; phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform; phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma; Phosphoinositide-3-kinase catalytic gamma polypeptide; phosphoinositide-3-kinase gamma catalytic subunit; phosphoinositide-3-kinase, catalytic, gamma polypeptide; PI3CG; PI3K; pi3kcg; Pi3kg1; PI3Kgamma; PI3K-gamma; PI3-kinase subunit gamma; PIK3; Pik3cg; ptdIns-3-kinase subunit gamma; ptdIns-3-kinase subunit p110-gamma; Serine/threonine protein kinase PIK3CG
• Common Name: PIK3CG
• Gene Symbol: PIK3CG
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining