Invitrogen™ Human PIK3C2B (aa 551-640) Control Fragment Recombinant Protein

Product Code. 30195286

Brand: Invitrogen™ RP94207

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56492 (PA5-56492. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Class II PI3 kinases, including PIK3C2B, phosphorylate the 3 position of PI or PI4P. Though not as well studied as the class I PI3 kinases, the class II enyzmes have been linked to diverse, receptor-mediated cellular processes including insulin signaling, neuronal survival, and growth factor signaling. Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains.

Specifications

• Accession Number: O00750
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5287
• Name: Human PIK3C2B (aa 551-640) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C2-PI3K; C330011J12Rik; Gm199; phosphatidylinositol 3-kinase C2 domain-containing beta polypeptide; phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta; phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit beta; phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta; phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 beta; phosphoinositide 3-kinase-C2-beta; phosphoinositide-3-kinase, class 2, beta polypeptide; pi3kc2b; PI3KC2beta; PI3K-C2beta; PI3K-C2-beta; PIK3C2B; PTDINS-3-kinase C2 beta; ptdIns-3-kinase C2 subunit beta
• Common Name: PIK3C2B
• Gene Symbol: PIK3C2B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ITSALNQLPPCPSRMQPKIQKDPSVLAVRENREKVVEALTAAILDLVELYCNTFNADFQTAVPGSRKHDLVQEACHFARSLAFTVYATHR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining