Invitrogen™ Human PIK3C2A (aa 174-263) Control Fragment Recombinant Protein

Product Code. 30208909

Brand: Invitrogen™ RP97268

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83384 (PA5-83384. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Class II PI3 kinases, including PIK3C2A, phosphorylate the 3 position of PI or PI4P. Though not as well studied as the Class I PI3 kinases, the Class II enyzmes have been linked to diverse, receptor-mediated cellular processes including insulin signaling, neuronal survival, and growth factor signaling. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is not sensitive to nanomolar levels of the inhibitor wortmanin. This protein was shown to be able to be activated by insulin and may be involved in integrin-dependent signaling.

Specifications

• Accession Number: O00443
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5286
• Name: Human PIK3C2A (aa 174-263) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C2-containing phosphatidylinositol kinase; CPK; Cpk-m; DKFZp686L193; MGC142218; p170; phosphatidylinositol 3-kinase, C2 domain containing, alpha polypeptide; phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha; phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit alpha; phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha; phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha; phosphoinositide 3-kinase-C2-alpha; phosphoinositide-3-kinase, class 2, alpha polypeptide; PI3KC2; PI3-K-C2(ALPHA); pi3kc2a; PI3-K-C2A; PI3K-C2alpha; PI3K-C2-alpha; Pik3c2a; ptdIns-3-kinase C2 subunit alpha
• Common Name: PIK3C2A
• Gene Symbol: PIK3C2A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PRMPTFPSTEPIYLSLPGQSPYFSYPLTPATPFHPQGSLPIYRPVVSTDMAKLFDKIASTSEFLKNGKARTDLEITDSKVSNLQVSPKSE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining