missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30193975

Invitrogen™ Human PIGZ (aa 276-318) Control Fragment Recombinant Protein

Product Code. 30193975
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30193975

Brand: Invitrogen™ RP101221

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63595 (PA5-63595. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. This gene encodes a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man)-dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q86VD9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80235
Name Human PIGZ (aa 276-318) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias dol-P-Man dependent GPI mannosyltransferase; F630022B06Rik; GPI mannosyltransferase 4; GPI mannosyltransferase IV; GPI-MT-IV; hSMP3; LOW QUALITY PROTEIN: GPI mannosyltransferase 4; phosphatidylinositol glycan anchor biosynthesis class Z; phosphatidylinositol glycan anchor biosynthesis, class Z; phosphatidylinositol glycan, class Z; phosphatidylinositol glycan, class Z-like 1; phosphatidylinositol-glycan biosynthesis class Z protein; Pigz; PIG-Z; Pigzl1; RGD1307107; SMP3; SMP3 homolog; SMP3 mannosyltransferase
Common Name PIGZ
Gene Symbol PIGZ
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DSWYFSSPATSRNLVLTPVNFLHYNLNPQNLARHGTHARLTHL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.