Invitrogen™ Human PIGA (aa 159-270) Control Fragment Recombinant Protein

Product Code. 30204726

Brand: Invitrogen™ RP91907

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51527 (PA5-51527. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein required for synthesis of N-acetylglucosaminyl phosphatidylinositol (GlcNAc-PI), the first intermediate in the biosynthetic pathway of GPI anchor. The GPI anchor is a glycolipid found on many blood cells and which serves to anchor proteins to the cell surface. Paroxysmal nocturnal hemoglobinuria, an acquired hematologic disorder, has been shown to result from mutations in this gene. Alternate splice variants have been characterized.

Specifications

• Accession Number: P37287
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5277
• Name: Human PIGA (aa 159-270) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI194334; class A GlcNAc-inositol phospholipid assembly protein; GLCNAC-PI synthesis protein; GPI anchor biosynthesis; GPI3; MCAHS2; N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein; phosphatidylinositol glycan anchor biosynthesis class A; phosphatidylinositol glycan anchor biosynthesis, class A; phosphatidylinositol glycan anchor biosynthesis, class A (paroxysmal nocturnal hemoglobinuria); phosphatidylinositol glycan, class A; phosphatidylinositol N-acetylglucosaminyltransferase subunit A; Phosphatidylinositol-glycan biosynthesis class A protein; phosphatidylinositol-glycan biosynthesis, class A protein; phosphatidylinositolglycan class A; PIGA; PIG-A; PNH1
• Common Name: PIGA
• Gene Symbol: PIGA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FADVSSVLTNKLLTVSLCDTNHIICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITIVVVSRLVYRKGIDLLSGIIPELCQKYPDLNFIIGGEGPKRII
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining