Invitrogen™ Human PIDD (aa 811-890) Control Fragment Recombinant Protein

Product Code. 30197954

Brand: Invitrogen™ RP109118

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene contains a leucine-rich repeat and a death domain. This protein has been shown to interact with other death domain proteins, such as Fas (TNFRSF6)-associated via death domain (FADD) and MAP-kinase activating death domain.

Specifications

• Accession Number: Q9HB75
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55367
• Name: Human PIDD (aa 811-890) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200011D09Rik; AU042446; DKFZp434D229; leucine-rich and death domain containing; leucine-rich repeat and death domain-containing protein; leucine-rich repeats and death domain containing; Lrdd; MGC16925; p53 induced death domain protein 1; p53 protein induced, with death domain; p53-induced death domain protein 1; p53-induced death domain-containing protein 1; p53-induced protein with a death domain; Pidd; Pidd1; PIDD-C; PIDD-CC; PIDD-N
• Common Name: PIDD
• Gene Symbol: PIDD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining