missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PIAS3 (aa 547-628) Control Fragment Recombinant Protein

Product Code. 30205786
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205786

Brand: Invitrogen™ RP107566

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66914 (PA5-66914. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The PIAS (protein inhibitor of activated STAT) proteins play a crucial role as transcriptional coregulators in various cellular pathways, including the STAT, p53 and the steroid hormone signaling pathway. The PIAS protein family includes at least five evolutionarily conserved genes, including PIAS3. The major function of the PIAS proteins is the control of gene transcription and can also act as small ubiquitin-like-modifier (SUMO) E3 ligases. PIAS3 binds specifically to STAT3 following the stimulation of STAT3. Increased expression of PIAS3 has been observed in several human cancers, including lung, breast, and brain tumors, but not in anaplastic lymphoma kinase-positive T/null-cell lymphomas, indicating that PIAS3 plays multiple roles in different tissue and cell types.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y6X2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10401
Name Human PIAS3 (aa 547-628) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias E3 SUMO-protein ligase PIAS3; E3 SUMO-protein transferase PIAS3; KChAP; PIAS3; Pias3l; potassium channel regulatory protein KChAP; potassium channel-associated protein; protein inhibitor of activated STAT 3; protein inhibitor of activated STAT protein 3; protein inhibitor of activated STAT, 3; zinc finger, MIZ-type containing 5; ZMIZ5
Common Name PIAS3
Gene Symbol PIAS3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPGGALREGHGGPLPSGPSLTGCRSDIISLD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.