Invitrogen™ Human PIAS3 (aa 463-600) Control Fragment Recombinant Protein

Product Code. 30197306

Brand: Invitrogen™ RP104011

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52288 (PA5-52288. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The PIAS (protein inhibitor of activated STAT) proteins play a crucial role as transcriptional coregulators in various cellular pathways, including the STAT, p53 and the steroid hormone signaling pathway. The PIAS protein family includes at least five evolutionarily conserved genes, including PIAS3. The major function of the PIAS proteins is the control of gene transcription and can also act as small ubiquitin-like-modifier (SUMO) E3 ligases. PIAS3 binds specifically to STAT3 following the stimulation of STAT3. Increased expression of PIAS3 has been observed in several human cancers, including lung, breast, and brain tumors, but not in anaplastic lymphoma kinase-positive T/null-cell lymphomas, indicating that PIAS3 plays multiple roles in different tissue and cell types.

Specifications

• Accession Number: Q9Y6X2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10401
• Name: Human PIAS3 (aa 463-600) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: E3 SUMO-protein ligase PIAS3; E3 SUMO-protein transferase PIAS3; KChAP; PIAS3; Pias3l; potassium channel regulatory protein KChAP; potassium channel-associated protein; protein inhibitor of activated STAT 3; protein inhibitor of activated STAT protein 3; protein inhibitor of activated STAT, 3; zinc finger, MIZ-type containing 5; ZMIZ5
• Common Name: PIAS3
• Gene Symbol: PIAS3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PTKKHCSVTSAAIPALPGSKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQHYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining