missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PI4KB (aa 517-660) Control Fragment Recombinant Protein

Product Code. 30210592
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210592

Brand: Invitrogen™ RP89168

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52271 (PA5-52271. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PI4KB and PI4KA are the two human type III PI4 kinases, which share sequence similarly with PI3 kinases and phosphorylate the 4 position of phosphotidyl inositol. Transporter for alanine, serine, cysteine, and threonine. Exhibits sodium dependence. Target protein phosphorylates phosphatidylinositol (PtdIns) at the D4 position of the inositol ring; may play a role in neuronal differentiation and maturation.
TRUSTED_SUSTAINABILITY

Specifikationer

Accession Number Q9UBF8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5298
Name Human PI4KB (aa 517-660) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias catalytic phosphatidylinositol 4-kinase beta; ESTM41; lipid kinase; DrPI4K III beta; NPIK; phosphatidylinositol 4-kinase; phosphatidylinositol 4-kinase beta; phosphatidylinositol 4-kinase III beta; phosphatidylinositol 4-kinase, catalytic, beta; phosphatidylinositol 4-kinase, catalytic, beta polypeptide; phosphatidylinositol 4-kinase, wortmannin-sensitive; PI4K92; PI4KB; PI4Kbeta; PI4K-beta; PI4KIII; PI4KIIIBETA; PI4KIII-beta; Pik4cb; PtdIns 4-kinase beta; type III phosphatidylinositol 4-kinase beta; zgc:152715
Common Name PI4KB
Gene Symbol Pi4kb
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TPTAFKRDPEDPSAVALKEPWQEKVRRIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.