Invitrogen™ Human PHYKPL (aa 323-363) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30198938	100 μL	100µL

Product Code. 30198938 Supplier Invitrogen™ Supplier No. RP107262

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84606 (PA5-84606. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This is a nuclear gene encoding a mitochondrial enzyme that catalyzes the conversion of 5-phosphonooxy-L-lysine to ammonia, inorganic phosphate, and 2-aminoadipate semialdehyde. Mutations in this gene may cause phosphohydroxylysinuria. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q8IUZ5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 85007
• Name: Human PHYKPL (aa 323-363) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900006B13Rik; 5-phosphohydroxy-L-lysine phospholyase; 5-phosphohydroxy-L-lysine phospho-lyase; 5-phosphonooxy-L-lysine phospho-lyase; Agxt2l2; Alanine--glyoxylate aminotransferase 2-like 2; alanine-glyoxylate aminotransferase 2-like 2; PHLU; PHYKPL; PP9286
• Common Name: PHYKPL
• Gene Symbol: PHYKPL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VLNVLEKEQLQDHATSVGSFLMQLLGQQKIKHPIVGDVRGV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining