Invitrogen™ Human PHOX2A (aa 247-284) Control Fragment Recombinant Protein

Product Code. 30209992

Brand: Invitrogen™ RP107444

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-66785 (PA5-66785, PA5-85047 (PA5-85047. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PHOX2A and PHOX2B (Paired mesoderm homeobox protein) are closely related, paired-homeodomain transcription factors that function as determinants of the noradrenergic phenotype during embryogenesis. PHOX2 proteins are crucial for the regulation of endogenous hydroxylases in neural crest cells and promote sympathetic neuron generation. Human PHOX2B contains one DNA binding homeobox domain and is required for the differentiation of all central and nonperipheral noradrenergic centers in the brain. In contrast, PHOX2A controls only the differentiation of the main noradrenergic center of the brain. Regulation of PHOX2 may have therapeutic utility in aging or disorders involving degeneration of noradrenergic neurons.

Specifications

• Accession Number: O14813
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 401
• Name: Human PHOX2A (aa 247-284) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: aristaless homeobox gene homolog; aristaless homeobox homolog; aristaless homeobox protein homolog; ARIX; arix homeodomain protein; ARI x 1 homeodomain protein; CFEOM2; FEOM2; NCAM2; paired like homeobox 2 A; paired mesoderm homeobox 2 A; paired mesoderm homeobox protein 2 A; Paired-like homeobox 2 A; Pho x 2; PHO x 2 A; PHO x 2 A homeodomain protein; Pm x 2; Pm x 2 A
• Common Name: PHOX2A
• Gene Symbol: PHOX2A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining