Invitrogen™ Human Phospholamban (aa 2-31) Control Fragment Recombinant Protein

Product Code. 30202253

Brand: Invitrogen™ RP90584

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82945 (PA5-82945. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Phospholamban (PLB) is a 52 amino acid phosphoprotein which regulates the calcium pump of cardiac sarcoplasmic reticulum (SR). PLB is an oligomer of five identical subunits each having a cytoplasmic and transmembrane domain. The cytoplasmic domain (residues 1 to 25) contains the phosphorylation sites and is highly basic and readily cleaved by proteases whereas the transmembrane domain (residues 25 to 52) is mostly hydrophobic, protease resistant and stabilizes the pentamer.

Specifications

• Accession Number: P26678
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5350
• Name: Human Phospholamban (aa 2-31) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: cardiac CMH18; Cardiac phospholamban; CMD1P; CMH18; phospholamban; Plb; Plm; PLN; unnamed protein product
• Common Name: Phospholamban
• Gene Symbol: PLN
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EKVQYLTRSAIRRASTIEMPQQARQKLQNL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining