Invitrogen™ Human PHOSPHO1 (aa 87-163) Control Fragment Recombinant Protein

Product Code. 30196904

Brand: Invitrogen™ RP108505

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84679 (PA5-84679. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Phosphatase that has a high activity toward phosphoethanolamine (PEA) and phosphocholine (PCho). Involved in the generation of inorganic phosphate for bone mineralization. [UniProt]

Specifications

• Accession Number: Q8TCT1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 162466
• Name: Human PHOSPHO1 (aa 87-163) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: D11Moh36; phosphatase, orphan 1; PHOSPHO1; Phosphoethanolamine/phosphocholine phosphatase; Phospo1
• Common Name: PHOSPHO1
• Gene Symbol: PHOSPHO1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RDLSAIYEAIPLSPGMSDLLQFVAKQGACFEVILISDANTFGVESSLRAAGHHSLFRRILSNPSGPDARGLLALRPF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining