Invitrogen™ Human PHKG2 (aa 368-406) Control Fragment Recombinant Protein

Product Code. 30202810

Brand: Invitrogen™ RP105457

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84787 (PA5-84787. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PHKG2 is a testis/liver isoform of the phosphorylase kinase gamma subunit. Phosphorylase kinase is a polymer of 16 subunits, four each of alpha, beta, gamma and delta. The alpha subunit includes the skeletal muscle and hepatic isoforms, encoded by two different genes. The beta subunit is the same in both the muscle and hepatic isoforms, and encoded by one gene. The gamma subunit also includes the skeletal muscle and hepatic isoforms, and the hepatic isoform is encoded by PHKG2. The delta subunit is a calmodulin and can be encoded by three different genes. The gamma subunits contain the active site of the enzyme, whereas the alpha and beta subunits have regulatory functions controlled by phosphorylation. The delta subunit mediates the dependence of the enzyme on calcium concentration. Mutations in PHKG2 cause glycogen storage disease type 9C, also known as autosomal liver glycogenosis. Alternatively spliced transcript variants encoding different isoforms have been identified in PHKG2.

Specifications

• Accession Number: P15735
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5261
• Name: Human PHKG2 (aa 368-406) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500017I02Rik; GSD9C; MGC129049 protein; phkg2; PHK-gamma-LT; PHK-gamma-T; Phosphorylase b kinase gamma catalytic chain, liver/testis isoform; phosphorylase b kinase gamma catalytic chain, testis/liver isoform; phosphorylase kinase; phosphorylase kinase catalytic subunit gamma 2; phosphorylase kinase gamma subunit 2; phosphorylase kinase subunit gamma 2; phosphorylase kinase subunit gamma-2; phosphorylase kinase, gamma 2 (testis); Phosphorylase kinase, gamma 2 (testis/liver); PSK-C3; serine/threonine-protein kinase PHKG2; similar to phosphorylase kinase, gamma 2 (testis); zgc:55863; zgc:55863 protein
• Common Name: PHKG2
• Gene Symbol: PHKG2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining