Invitrogen™ Human PHKG1 (aa 10-132) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30207735	100 μL	100µL

Product Code. 30207735 Supplier Invitrogen™ Supplier No. RP89806

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52902 (PA5-52902. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PHKG1 is a serine/threonine kinase with glycogenolytic regulatory functions. This protein is the catalytic member of a 16 subunit protein kinase complex which contains equimolar ratios of 4 subunit types. The complex is a crucial glycogenolytic regulatory enzyme. PHKG1 has two pseudogenes at chromosome 7q11.21 and one at chromosome 11p11.12.

Specifications

• Accession Number: Q16816
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5260
• Name: Human PHKG1 (aa 10-132) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: gamma phosphorylase kinase; MGC137450 protein; PHGK; PHKG; PHKG1; PHKgammaM; PHK-gammaM; PHK-gamma-M; PHKgamma-M; PHKIN01; phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform; Phosphorylase B kinase gamma catalytic chain, skeletal muscle isoform (Phosphorylase kinase gamma subunit 1); phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform; phosphorylase kinase; phosphorylase kinase catalytic subunit gamma 1; phosphorylase kinase gamma; phosphorylase kinase gamma 1; phosphorylase kinase gamma subunit; phosphorylase kinase gamma subunit 1; phosphorylase kinase subunit gamma 1; phosphorylase kinase subunit gamma-1; phosphorylase kinase, gamma 1; phosphorylase kinase, gamma 1 (muscle); serine/threonine-protein kinase PHKG1; unnamed protein product
• Common Name: PHKG1
• Gene Symbol: PHKG1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFSPEEVRELREATLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKVTLSEKETRKIMR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining