Invitrogen™ Human PHKA2 (aa 596-729) Control Fragment Recombinant Protein

Product Code. 30196411

Brand: Invitrogen™ RP92162

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51772 (PA5-51772. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Phosphorylase b kinase catalyzes the phosphorylation of serine in certain substrates, including troponin I. The alpha chain may bind calmodulin.

Specifications

• Accession Number: P46019
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5256
• Name: Human PHKA2 (aa 596-729) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6330505C01Rik; D330034O08; GSD9A; Phk; Phka2; PHKLA; phosphorylase b kinase regulatory subunit alpha liver isoform; phosphorylase b kinase regulatory subunit alpha, liver isoform; phosphorylase kinase; phosphorylase kinase alpha 2; phosphorylase kinase alpha L subunit; phosphorylase kinase alpha-subunit; phosphorylase kinase regulatory subunit alpha 2; phosphorylase kinase, alpha 2; phosphorylase kinase, alpha 2 (liver); PYK; PYKL; RP3-499B10.2; XLG; XLG2
• Common Name: PHKA2
• Gene Symbol: PHKA2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GARVKLGNLSEFLTTSFYTYLTFLDPDCDEKLFDNASEGTFSPDSDSDLVGYLEDTCNQESQDELDHYINHLLQSTSLRSYLPPLCKNTEDRHVFSAIHSTRDILSVMAKAKGLEVPFVPMTLPTKVLSAHRKS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining