Invitrogen™ Human PHIP (aa 1615-1739) Control Fragment Recombinant Protein

Product Code. 30197931

Brand: Invitrogen™ RP92477

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53938 (PA5-53938. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PHIP (pleckstrin homology domain interacting protein), also known as ndrp or WDR11, is a 1,821 amino acid protein that contains eight N-terminal WD40 repeats and two bromodomains. It is expressed in skeletal muscle (localizing to the cytosol and nucleus) and primary beta cells (localizing to the nucleus) and acts as a transcriptional activator. PHIP is known to interact with various members of the insulin receptor substrate (IRS) family. The IRS family of proteins mediate insulin receptor signaling and play an important role in insulin-producing beta cell proliferation and survival. PHIP specifically associates with the PH domain of IRS-1 and may function to link IRS-1 to insulin receptors, indicating a vital role of PHIP in the regulation of insulin signaling.

Specifications

• Accession Number: Q8WWQ0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55023
• Name: Human PHIP (aa 1615-1739) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810004D21Rik; 4632404O06Rik; BRWD2; DCAF14; DDB1 and CUL4 associated factor 14; DDB1- and CUL4-associated factor 14; FLJ20705; IRS-1 PH domain-binding protein; Ndrp; neuronal differentiation related protein; neuronal differentiation-related protein; PH-interacting protein; PHIP; pleckstrin homology domain interacting protein; WD repeat domain 11; WD repeat-containing protein 11; WDR11
• Common Name: PHIP
• Gene Symbol: PHIP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NALVPGTIQVNGHGGQPSKLVKRGPGRKPKVEVNTNSGEIIHKKRGRKPKKLQYAKPEDLEQNNVHPIRDEVLPSSTCNFLSETNNVKEDLLQKKNRGGRKPKRKMKTQKLDADLLVPASVKVLR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining