Invitrogen™ Human PHF8 (aa 750-859) Control Fragment Recombinant Protein

Product Code. 30204102

Brand: Invitrogen™ RP95462

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58537 (PA5-58537. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PHD finger protein 8 is a jumonji domain containing protein. Like other members of the jumonji family, PHF8 may therefore play a role in histone demethylation. Mutations in PHF8 lead to Siderius type X-linked mental retardation (MRXSSD), a mild to borderline type of mental retardation.

Specifications

• Accession Number: Q9UPP1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23133
• Name: Human PHF8 (aa 750-859) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9830141C09Rik; histone lysine demethylase PHF8; JHDM1F; jumonji C domain-containing histone demethylase 1 F; Kiaa1111; mKIAA1111; MRXSSD; PHD finger protein 8; PHF8; RGD1561065; ZNF422
• Common Name: PHF8
• Gene Symbol: PHF8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASPSTQEAIQGMLCMANLQSSSSSPATSSLQAWWTGGQDRSSGSSSSGLGTVSNSPASQRTPGKRPIKRPAYWRTESEEEEENASLDEQDSLGACFKDAEYIYPSLESDD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining