Invitrogen™ Human PHF22 (aa 98-191) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30195322	100 μL	100µL

Product Code. 30195322 Supplier Invitrogen™ Supplier No. RP96667

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57394 (PA5-57394. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

INTS12 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit and mediates 3-prime end processing of small nuclear RNAs U1 and U2.

Specifications

• Accession Number: Q96CB8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57117
• Name: Human PHF22 (aa 98-191) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110020M19Rik; 2810027J24Rik; 4930529N21Rik; A230056J18Rik; AI666778; hypothetical nuclear factor SBBI22; hypothetical protein LOC415251; int12; Integrator complex subunit 12; INTS12; PHD finger protein 22; PHF22; SBBI22; Unknown (protein for MGC:134302); wu:fi17f05; zgc:86602
• Common Name: PHF22
• Gene Symbol: Ints12
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KRPADKMKSDITEGVDIPKKPRLEKPETQSSPITVQSSKDLPMADLSSFEETSADDFAMEMGLACVVCRQMMVASGNQLVECQECHNLYHRDCH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining