Invitrogen™ Human PHF21A (aa 578-676) Control Fragment Recombinant Protein

Product Code. 30206194

Brand: Invitrogen™ RP93601

Descrizione

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54829 (PA5-54829. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PHF21A (PHD finger protein 21A) is a component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, PHF21A may act as a scaffold.

Specifica

• Accession Number: Q96BD5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51317
• Name: Human PHF21A (aa 578-676) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 80 kDa; Bhc; Bhc80; BHC80a; BM-006; Braf35/HDAC complex (Bhc); BRAF35/HDAC2 complex; BRAF35/HDAC2 complex (80 kDa); BRAF35-HDAC complex protein BHC80; D030065N23Rik; KIAA1696; mBHC80; PFTF1; PHD finger protein 21 A; Phf21a; RGD1560612
• Common Name: PHF21A
• Gene Symbol: Phf21a
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QEREQLEQKVKQLSNSISKCMEMKNTILARQKEMHSSLEKVKQLIRLIHGIDLSKPVDSEATVGAISNGPDCTPPANAATSTPAPSPSSQSCTANCNQG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining