Invitrogen™ Human PHF16 (aa 703-785) Control Fragment Recombinant Protein

Product Code. 30208551

Brand: Invitrogen™ RP105332

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66708 (PA5-66708. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is part of a gene cluster on chromosome Xp11.23. The encoded protein contains a zinc finger motif often found in transcriptional regulators, however, its exact function is not known. Alternative splicing results in multiple transcript variants encoding the same protein.

Specifications

• Accession Number: Q92613
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9767
• Name: Human PHF16 (aa 703-785) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730598B06; AI851988; AW544806; jade family PHD finger 3; jade family PHD finger protein 3; JADE3; JADE-3; KIAA0215; mKIAA0215; PHD finger protein 16; PHF16; Protein Jade-3
• Common Name: PHF16
• Gene Symbol: JADE3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SFRKSTVEHFSRSFKETTNRWVKNTEDLQCYVKPTKNMSPKEQFWGRQVLRRSAGRAPYQENDGYCPDLELSDSEAESDGNKE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining