Invitrogen™ Human PHD1 (aa 9-87) Control Fragment Recombinant Protein

Product Code. 30211699

Brand: Invitrogen™ RP106720

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84303 (PA5-84303. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Prolyl hydroxylase domain proteins HIF PHD1, HIF PHD2 and HIF PHD3 (known as PHD1, PHD2 and PHD3 in rodents, respectively) can hydroxylate HIF-alpha subunits. Hypoxia-inducible factor (HIF) is a transcriptional regulator important in several aspects of oxygen homeostasis. The prolyl hydroxylases catalyze the posttranslational formation of 4-hydroxyproline in HIF-alpha proteins. HIF PHD1, which is widely expressed, with highest levels of expression in testis, functions as a cellular oxygen sensor and is important in cell growth regulation. HIF PHD1 can localize to the nucleus or the cytoplasm and is also detected in hormone responsive tissues, such as normal and cancerous mammary, ovarian and prostate epithelium. HIF PHD1 is encoded by EGLN2, which maps to chromosome 19q13. 3.

Specifications

• Accession Number: Q96KS0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 112398
• Name: Human PHD1 (aa 9-87) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610011A13Rik; C85656; egl nine homolog 2; egl-9 family hypoxia inducible factor 2; egl-9 family hypoxia-inducible factor 2; Egln2; EIT6; EIT-6; Estrogen-induced tag 6; falkor; HIF-1 alpha prolyl-4-hydroxylase-1; HIF-P4H 1; Hif-p4h-1; HIFPH1; HIF-PH1; HIF-prolyl hydroxylase 1; HPH-1; HPH-3; Hypoxia-inducible factor prolyl hydroxylase 1; Ier4; immediate early response 4; P4H1; Phd1; PHD-1; Prolyl hydroxylase domain-containing protein 1; SM-20
• Common Name: PHD1
• Gene Symbol: EGLN2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATSTTASPLRDGFGGQDGGE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining